PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G385450.1.p
Common NameSb02g040160, SORBIDRAFT_02g040160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 329aa    MW: 34732.9 Da    PI: 7.9133
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G385450.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd+ lv +++++G+g+W++++++ g+ R+ k+c++rw +yl
  Sobic.002G385450.1.p 14 KGPWTPEEDLVLVSYIQEHGPGNWRAVPAKTGLMRCSKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding51.81.8e-1667112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T++E++l++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Sobic.002G385450.1.p  67 RGNFTEQEEKLIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.316961IPR017930Myb domain
SuperFamilySSF466892.32E-3011108IPR009057Homeodomain-like
SMARTSM007174.0E-131363IPR001005SANT/Myb domain
PfamPF002497.2E-161461IPR001005SANT/Myb domain
CDDcd001671.23E-111661No hitNo description
PROSITE profilePS5129425.46262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-2565116IPR009057Homeodomain-like
SMARTSM007177.2E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1567112IPR001005SANT/Myb domain
CDDcd001671.00E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVRPPCCDKE GVKKGPWTPE EDLVLVSYIQ EHGPGNWRAV PAKTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TEQEEKLIIH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKRKLQSGG  120
GDGAAKPPAH RPPSSSKGQW ERRLQTDINL ARRALREALT PLDDLKPPQL QRDATAVDAP  180
GAGLGVGGGD SPASSSSGAS QCSPSSAPAA AATAAGPYVL TTENISRMLD GWAGRKAARG  240
GSPGTPGGAE SASTGSSDAS EVSYGGGAAV TLAAAGGPVF EFETKPTVPP AQQMPLSAIE  300
SWLFDDDSHF HHVQSAGVLD AAPMDYPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-28141164105C-Myb DNA-Binding Domain
1msf_C2e-28141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9554750.0EU955475.1 Zea mays clone 1533591 MYB94 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463232.10.0hypothetical protein SORBIDRAFT_02g040160
SwissprotP813924e-98MYB06_ANTMA; Myb-related protein 306
TrEMBLC5X3680.0C5X368_SORBI; Putative uncharacterized protein Sb02g040160
STRINGSb02g040160.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.13e-90myb domain protein 30